DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and BLH4

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001324137.1 Gene:BLH4 / 816908 AraportID:AT2G23760 Length:679 Species:Arabidopsis thaliana


Alignment Length:153 Identity:41/153 - (26%)
Similarity:60/153 - (39%) Gaps:65/153 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EHGANQVQNYHDM-MVDSEHHIDINGSLRKRRGNLPKTSVKILKRWLYEHRYN------------ 118
            |....|.:.:|.| |::.|       :.|.:|| ||:.||.||:.||:||..|            
plant   405 EQSLRQQRAFHHMGMMEQE-------AWRPQRG-LPERSVNILRAWLFEHFLNPFSRPCKEKVCT 461

  Fly   119 ----------------------------------------AYPSDAEKFTLSQEANLTVLQVCNW 143
                                                    .|||||:|..|:::..|:..||.||
plant   462 FSCIYLIVFFLSIYIQKKRKEKNYWFRVLKIVKSFSGLFLRYPSDADKHLLARQTGLSRNQVSNW 526

  Fly   144 FINARRRI----LPEMIRREGND 162
            |||||.|:    :.||.::|..:
plant   527 FINARVRLWKPMVEEMYQQEAKE 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 22/90 (24%)
BLH4NP_001324137.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.