DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and pknox1.1

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_571966.3 Gene:pknox1.1 / 798151 ZFINID:ZDB-GENE-020122-5 Length:433 Species:Danio rerio


Alignment Length:263 Identity:64/263 - (24%)
Similarity:108/263 - (41%) Gaps:81/263 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QSTEHGANQVQNYHDMMVDSEHHIDINGSL----------RKRRGNLPKTSVKILKRWLYEHRYN 118
            |:...||..:||       |:..:.:|..|          :.:||.|||.:..:::.||::|..:
Zfish   234 QAISPGALHIQN-------SQLQLQLNQDLSFFGGDDSSPKNKRGVLPKQATNVMRSWLFQHIAH 291

  Fly   119 AYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVSPNCSRSS 183
            .||::.||..::.:.|||:|||.|||||||||||..|:.....:     .|:..|||:.:     
Zfish   292 PYPTEEEKKQIATQTNLTLLQVNNWFINARRRILQPMLDANSTE-----ASKSKKKVAQS----- 346

  Fly   184 ALGANLTGPNPAHGSPASEVVVGATEEVDGAGEIHEGIANVLTNFEQYVQGPNGQMVKMEPEYED 248
                     .|.|...:                  :.||:  |..:|.:..|:|.:|        
Zfish   347 ---------RPLHRFWS------------------DSIAS--TGSQQQLTMPDGSLV-------- 374

  Fly   249 SVIYSWQQAIANNPMGFQSLHSSLQATMIDKIKNYQMRKAAAIGGSAVGSGGAGGSSSNSSPATS 313
                    .:..|..|||:| ||..||:        ..:...:|..:.......|:..::..:|:
Zfish   375 --------TVGMNVDGFQAL-SSDGATL--------AMQQVLMGNHSEDETDESGNEDDTDMSTA 422

  Fly   314 ILP 316
            .:|
Zfish   423 NMP 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 20/38 (53%)
pknox1.1NP_571966.3 Meis_PKNOX_N 82..166 CDD:293102
Homeobox_KN 284..323 CDD:283551 20/38 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587155
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.