DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and TGIF2

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001186442.1 Gene:TGIF2 / 60436 HGNCID:15764 Length:237 Species:Homo sapiens


Alignment Length:181 Identity:78/181 - (43%)
Similarity:94/181 - (51%) Gaps:45/181 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 RKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRR 158
            |||||||||.|||||:.|||.||||||||:.||.:||.:.||:|||:||||||||||:||:|:|:
Human    19 RKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRK 83

  Fly   159 EGNDPLHFTISRRGKKVS----PNCSRSSALGANLTGPN----------PAHG------------ 197
            :|.||..|||||||.|.|    |..|..|.|..::..|.          |.|.            
Human    84 DGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPR 148

  Fly   198 ----SPASEVVVGATEEVDGAGEIHEGIANVLTNFEQYVQGPNGQMVKMEP 244
                ||...|..|:|             ..:||..|  ...|.|.:....|
Human   149 GELESPKPLVTPGST-------------LTLLTRAE--AGSPTGGLFNTPP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 28/38 (74%)
TGIF2NP_001186442.1 Homeobox_KN 36..75 CDD:399131 28/38 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..106 11/18 (61%)
Repressive function 103..237 18/97 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..193 3/13 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..237
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152658
Domainoid 1 1.000 73 1.000 Domainoid score I9250
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1573375at2759
OrthoFinder 1 1.000 - - FOG0002434
OrthoInspector 1 1.000 - - mtm8506
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2583
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.