DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and pbx2

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_017206849.1 Gene:pbx2 / 58136 ZFINID:ZDB-GENE-000405-5 Length:420 Species:Danio rerio


Alignment Length:184 Identity:43/184 - (23%)
Similarity:72/184 - (39%) Gaps:46/184 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 RKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRR 158
            |::|.|..|.:.::|..:.|.|..|.|||:..|..|:::.::||.||.|||.|.|.|....:.:.
Zfish   253 RRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKQCSITVSQVSNWFGNKRIRYKKNIGKY 317

  Fly   159 EGNDPLHFTISRRGKKVSPNCSRSSALGA----------NLTGPNPAHGSPASEVVVGATEEVDG 213
            :....|:              :..:||||          |.||......|.:::..:|.......
Zfish   318 QEEANLY--------------AMKTALGATQSEDSPHTPNSTGSGSFSLSGSADCFLGVPPMNGE 368

  Fly   214 AGEIHEGIANVLTNFEQ--YV---QGPNGQMVKMEPEYEDSVIYSWQQAIANNP 262
            ....|.|..:..:.|.:  |:   ...||               :||:  .|:|
Zfish   369 QPPYHMGAQDAQSRFSERLYITRESRTNG---------------NWQE--QNSP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 17/38 (45%)
pbx2XP_017206849.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587136
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.