DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and pbx1b

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_021332595.1 Gene:pbx1b / 570960 ZFINID:ZDB-GENE-070424-11 Length:433 Species:Danio rerio


Alignment Length:295 Identity:74/295 - (25%)
Similarity:124/295 - (42%) Gaps:62/295 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HVQASLLENEGRGRFHSDSSLDQ--DSLH---ADVIVEEDQSTEHGANQVQNYHDMMVDSEHHID 88
            ||. :||..:.|.|..|...:::  ..:|   :.:.::..|||         ...:|:.....:|
Zfish   181 HVM-NLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQST---------CEAVMILRSRFLD 235

  Fly    89 INGSLRKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILP 153
                .|::|.|..|.:.:||..:.|.|..|.|||:..|..|:::.::||.||.|||.|.|     
Zfish   236 ----ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKR----- 291

  Fly   154 EMIRREGNDPLHFTISRRGKKVSPNCSRSSALGANLTGPNPAHGSPASEVVVGATEEVDGAGEIH 218
              ||.:.|      |.:..::.:...:|::...|:::    ||||.|:     :....:.||.  
Zfish   292 --IRYKKN------IGKFQEEANMYAARTAVNAASVS----AHGSQAN-----SPSTPNSAGS-- 337

  Fly   219 EGIANVLTNFEQY--VQGPNGQMVKMEPEYEDSVIYSWQQAIANNPMGFQSLHSSLQATMIDKIK 281
            .|..|:..:.:.:  ||..||          ||  |...|..||    .||...:|: .:|.:..
Zfish   338 AGSFNMSNSGDLFMSVQSLNG----------DS--YQGSQVGAN----VQSQVDTLR-HVISQTG 385

  Fly   282 NYQMRKAAAIGGSAVGSGGAGGSSSNSSPATSILP 316
            .|....||....|..|....||....::|::...|
Zfish   386 GYSDGLAANQMYSPQGINANGGWQDPTTPSSVTSP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 17/38 (45%)
pbx1bXP_021332595.1 PBC 39..235 CDD:309062 12/63 (19%)
homeodomain 237..297 CDD:238039 25/66 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587174
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.