DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and MEIS3

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_024307380.1 Gene:MEIS3 / 56917 HGNCID:29537 Length:509 Species:Homo sapiens


Alignment Length:240 Identity:58/240 - (24%)
Similarity:84/240 - (35%) Gaps:91/240 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ENEGRGRFH---------------SDSSLDQ-DSLHADVIVEEDQSTEHGANQVQNYHDMMVDSE 84
            ::|..|..|               .|:|.|| |.|...|           |:......|..:|.|
Human   294 DHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSV-----------ASPSSGGEDEDLDQE 347

  Fly    85 HHIDINGSLRKRRGNLPKTSVKILKRWLYEH------------------------RY-------- 117
            ..      ..|:||..||.:..|::.||::|                        |:        
Human   348 RR------RNKKRGIFPKVATNIMRAWLFQHLSRRSEAPVLPDVCLGLGSPSPGPRWARPWGSDC 406

  Fly   118 --------------NAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTI 168
                          :.|||:.:|..|:|:..||:|||.||||||||||:..||.:..........
Human   407 GRPGRQSDSCWWLQHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAF 471

  Fly   169 SRRGKKVSPNCSRSSALGANLTGPNPAHGSPASEVVVGATEEVDG 213
            |..|:.:.         |...|.|:.|...|.|   ||.:..::|
Human   472 SPEGQPIG---------GYTETQPHVAVRPPGS---VGMSLNLEG 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 22/84 (26%)
MEIS3XP_024307380.1 Meis_PKNOX_N 184..267 CDD:318653
Homeobox_KN 417..453 CDD:310480 18/35 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152661
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.