DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and PBX3

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_006717193.1 Gene:PBX3 / 5090 HGNCID:8634 Length:455 Species:Homo sapiens


Alignment Length:308 Identity:63/308 - (20%)
Similarity:102/308 - (33%) Gaps:102/308 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HVQASLLENEGRGRFHSDSSLDQ--DSLH---ADVIVEEDQSTEHGANQVQNYHDMMVDSEHHID 88
            ||. :||..:.|.|..|...:::  ..:|   :.:.::..|||         ...:|:.....:|
Human   180 HVM-NLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQST---------CEAVMILRSRFLD 234

  Fly    89 INGSLRKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQ-------------- 139
                .|::|.|..|.:.:||..:.|.|..|.|||:..|..|:::.::||.|              
Human   235 ----ARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQSLVKDPKERGSKGS 295

  Fly   140 -------VCNWFINARRR--------------------------ILPEMIRREGNDPLHFTISRR 171
                   |.|||.|.|.|                          :...:...:.|.|   |....
Human   296 DIQPTSVVSNWFGNKRIRYKKNIGKFQEEANLYAAKTAVTAAHAVAAAVQNNQTNSP---TTPNS 357

  Fly   172 GKKVSPNCSRSSALGANLTGPNPAHGSPASEVVVGATEEVDGAGEIHEGIANVLTNFEQYVQGPN 236
            |...|.|...|..:..|:...| ......|:|......:||       .:.:|:.....|..|..
Human   358 GSSGSFNLPNSGDMFMNMQSLN-GDSYQGSQVGANVQSQVD-------TLRHVINQTGGYSDGLG 414

  Fly   237 GQMVKMEPEYEDSVIYS---------WQQA-----IANNPMGFQSLHS 270
            |           :.:||         ||.|     :.:...|..|:||
Human   415 G-----------NSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHS 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 17/59 (29%)
PBX3XP_006717193.1 PBC 43..234 CDD:281746 12/63 (19%)
homeodomain 236..317 CDD:238039 24/80 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152682
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.