DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and Tgif2

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001128455.1 Gene:Tgif2 / 499929 RGDID:1560115 Length:237 Species:Rattus norvegicus


Alignment Length:193 Identity:80/193 - (41%)
Similarity:100/193 - (51%) Gaps:46/193 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 DSEHHIDINGSLRKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFIN 146
            :.|..:.:.|. |||||||||.|||||:.|||.||||||||:.||.:||.:.||:|||:||||||
  Rat     8 EDEGLLSLTGK-RKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFIN 71

  Fly   147 ARRRILPEMIRREGNDPLHFTISRRGKKVS----PNCSRSSALGANLTGPN----------PAHG 197
            ||||:||:|:|::|.||..|||||||.|.|    |..|..|.|..::..|.          |.|.
  Rat    72 ARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSLLAVSVPAPTNMLSLSVCSMPLHS 136

  Fly   198 ----------------SPASEVVVGATEEVDGAGEIHEGIANVLTNFEQYVQGPNGQMVKMEP 244
                            ||.:.|..|:|             ..:||..|  ...|.|.:....|
  Rat   137 GQGEKPAASFPQVELESPKALVTPGST-------------LTLLTRAE--AGSPTGGLFNTPP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 28/38 (74%)
Tgif2NP_001128455.1 Homeobox_KN 36..75 CDD:399131 28/38 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346183
Domainoid 1 1.000 73 1.000 Domainoid score I9009
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1573375at2759
OrthoFinder 1 1.000 - - FOG0002434
OrthoInspector 1 1.000 - - mtm8979
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2583
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.