DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and Irx5

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001025215.1 Gene:Irx5 / 498918 RGDID:1565518 Length:484 Species:Rattus norvegicus


Alignment Length:328 Identity:78/328 - (23%)
Similarity:108/328 - (32%) Gaps:110/328 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 RGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRIL--------- 152
            |.|..:.:...||.||.|||.|.||:..||..|:....:|:.||..||:|||||:.         
  Rat   116 RKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFVNARRRLKKENKMTWTP 180

  Fly   153 ---------PEMIRREGNDP------------------------------LHFTISRRGKKVSPN 178
                     .|.|..|.||.                              |...:|..||:...:
  Rat   181 RNRSEDEEEEENIDLEKNDEDEPQKPEDKGDLEGPEAGGTEQKAAAGCERLQGPLSPAGKETEGS 245

  Fly   179 CSRSSALGANLTG--------PNPAHGSPASEVVVGATEEVDGAGEIHEGIANVLTNFEQYVQGP 235
            .|.|....:...|        |.....|||........|:   ||..:...|.        ..||
  Rat   246 LSDSDFKESPSEGRHDDLPRPPRAGEPSPAGPATARLAED---AGPHYPAGAP--------APGP 299

  Fly   236 NGQMVKMEP-EYEDSVIYS------WQQAIANNPMGFQSLHSSLQ-ATMIDKIKNYQMRKAAAIG 292
            :....::.| ....|||:|      ...|:...|    .|.|..: ||..||:|:.        |
  Rat   300 HPSAGELPPGSGGSSVIHSPPPPPPPPPAVLAKP----KLWSLAEIATSSDKVKDG--------G 352

  Fly   293 GSAVGS---------GG--AGGSSSNSSPATSILPYSLFGQLPPEFDDEEKPRPPKRVRTRTVAA 346
            |.:.||         ||  .|||.::.:||            |......:.|.|...|.:|.:..
  Rat   353 GGSEGSPCPPCPGPIGGQTLGGSRASPAPA------------PARSPSAQCPFPGGTVLSRPLYY 405

  Fly   347 KSP 349
            .:|
  Rat   406 TAP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 19/38 (50%)
Irx5NP_001025215.1 Homeobox_KN 130..169 CDD:283551 19/38 (50%)
IRO 328..345 CDD:214716 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.