DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and irx4b

DIOPT Version :10

Sequence 1:NP_725183.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001018329.2 Gene:irx4b / 474318 ZFINID:ZDB-GENE-040712-4 Length:439 Species:Danio rerio


Alignment Length:59 Identity:26/59 - (44%)
Similarity:34/59 - (57%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPE 154
            ||.|..:.:...||.||.||:.|.||:..||..|:....:|:.||..||.|||||:..|
Zfish   142 RRKNATRETTSTLKAWLQEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_725183.1 Homeobox_KN 112..150 CDD:428673 17/37 (46%)
irx4bNP_001018329.2 COG5576 <136..>214 CDD:227863 26/59 (44%)
Homeobox_KN 158..196 CDD:428673 17/37 (46%)
Spt5_N 212..>266 CDD:463406
IRO <336..348 CDD:214716
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.