Sequence 1: | NP_001286352.1 | Gene: | achi / 36373 | FlyBaseID: | FBgn0033749 | Length: | 555 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012819925.1 | Gene: | tgif1 / 395014 | XenbaseID: | XB-GENE-853021 | Length: | 322 | Species: | Xenopus tropicalis |
Alignment Length: | 247 | Identity: | 84/247 - (34%) |
---|---|---|---|
Similarity: | 115/247 - (46%) | Gaps: | 74/247 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 94 RKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRR 158
Fly 159 EGNDPLHFTISRRGKKVS-----------------------------PNCSRSSALGANLTGPNP 194
Fly 195 AHGSPASEVVVGATEEVDGAGEIHEGIANVLTNFEQYV---QGPNGQMVKMEPEYEDSVIY---- 252
Fly 253 -------SWQQAIANNP-----------MGFQSL---------HSSLQATMI 277 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
achi | NP_001286352.1 | Homeobox_KN | 111..150 | CDD:283551 | 28/38 (74%) |
tgif1 | XP_012819925.1 | Homeobox_KN | 103..142 | CDD:368670 | 28/38 (74%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1573375at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0002434 | |
OrthoInspector | 1 | 1.000 | - | - | mtm9404 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X2583 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 5.010 |