DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and tgif1

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_012819925.1 Gene:tgif1 / 395014 XenbaseID:XB-GENE-853021 Length:322 Species:Xenopus tropicalis


Alignment Length:247 Identity:84/247 - (34%)
Similarity:115/247 - (46%) Gaps:74/247 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 RKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRR 158
            |:|||||||.||:||:.||||||||||||:.||..||::.:|:.|||||||||||||:||:|:|:
 Frog    86 RRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSRQTHLSTLQVCNWFINARRRLLPDMLRK 150

  Fly   159 EGNDPLHFTISRRGKKVS-----------------------------PNCSRSSALGANLTGPNP 194
            :|.||..|||||:|.|:|                             ||.|....|.:.|:.|..
 Frog   151 DGKDPNQFTISRKGAKISDVIQMDSPTGTKPYIPTIDENSFHFTSSGPNQSSGKLLASKLSPPQS 215

  Fly   195 AHGSPASEVVVGATEEVDGAGEIHEGIANVLTNFEQYV---QGPNGQMVKMEPEYEDSVIY---- 252
            ....|:  |:...|.         ..:::...||...:   |.|:.|..:.....|.|::|    
 Frog   216 LLARPS--VICHTTV---------TSLSDAPFNFTHVLNAGQIPDPQQTEASNLTETSILYHEDT 269

  Fly   253 -------SWQQAIANNP-----------MGFQSL---------HSSLQATMI 277
                   :.|..:.|.|           .|||.|         ...|||.::
 Frog   270 SKLGQNTNAQSGLFNTPPPTPPDHNQDFSGFQLLVDVALKQAAEMELQAKLV 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 28/38 (74%)
tgif1XP_012819925.1 Homeobox_KN 103..142 CDD:368670 28/38 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1573375at2759
OrthoFinder 1 1.000 - - FOG0002434
OrthoInspector 1 1.000 - - mtm9404
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2583
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.