DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and irx2a

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_957351.1 Gene:irx2a / 394032 ZFINID:ZDB-GENE-040426-1446 Length:432 Species:Danio rerio


Alignment Length:279 Identity:62/279 - (22%)
Similarity:92/279 - (32%) Gaps:80/279 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 RGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPE------- 154
            |.|..:.:...||.||.|||.|.||:..:|..|:....:|:.||..||.|||||:..|       
Zfish   108 RKNATRDATATLKAWLQEHRKNPYPTKGQKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAP 172

  Fly   155 MIRREGNDPLHFTISRRGKKVSPNCSRSSALGAN---------LTGPNPAHGSPASEVVVGATEE 210
            ..:.|..|.......|:.::...|...|.|...:         ||..:.:..|...:|.....:.
Zfish   173 RNKSEDEDEDDGDGERKDERTDKNMDNSEASAEDEGISLHVDALTDHSCSVESDGEKVTCRTGDL 237

  Fly   211 V-DGAGEIHE--------------------------GIANVLTNFEQYVQGPN-----GQMVKME 243
            | |...||.:                          |:...|..........|     ||...::
Zfish   238 VCDSGAEIQDKCEATDLGEERQRGASPKPVTSSPLTGVEAPLLTHHHRENSTNKTCLDGQNQTVK 302

  Fly   244 PEYEDSVIYSWQQAIANNPMGFQSLHSSLQATMIDKIKNYQMRKAAAIG---GSAVGSGGAGGSS 305
            |:     ::|..:...::|.                    |......:|   .||.|:..||.  
Zfish   303 PK-----LWSLAEIATSDPK--------------------QQNCPPGVGLLTSSAPGASPAGA-- 340

  Fly   306 SNSSPATSILPYSLFGQLP 324
              ..||||||...|:...|
Zfish   341 --VYPATSILGRPLYYTSP 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 18/38 (47%)
irx2aNP_957351.1 Homeobox_KN 122..161 CDD:283551 18/38 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.