DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and exd

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster


Alignment Length:183 Identity:46/183 - (25%)
Similarity:72/183 - (39%) Gaps:51/183 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 RKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRR 158
            |::|.|..|.:.:||..:.|.|..|.|||:..|..|:::..:||.||.|||.|.|       ||.
  Fly   239 RRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKR-------IRY 296

  Fly   159 EGNDPLHFTISRRGKKVSPNCSRSSALGA---NLTGPNPAHGSPASEVVVGATEEVDGAGEIHEG 220
            :.|      |.:..::.:...::.:| ||   ::.||.....:|    ::......|..|     
  Fly   297 KKN------IGKAQEEANLYAAKKAA-GASPYSMAGPPSGTTTP----MMSPAPPQDSMG----- 345

  Fly   221 IANVLTNFEQYVQGPNGQMVKMEPEYEDSVIYSWQQAIANNPMGFQ-SLHSSL 272
                      |..|..|              |..||...|:..|:. :||..|
  Fly   346 ----------YPMGSGG--------------YDQQQPYDNSMGGYDPNLHQDL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 17/38 (45%)
exdNP_001259592.1 PBC 41..237 CDD:397732
homeodomain 239..299 CDD:238039 25/66 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457279
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.