DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and irx3b

DIOPT Version :10

Sequence 1:NP_725183.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_998265.2 Gene:irx3b / 321806 ZFINID:ZDB-GENE-030131-525 Length:343 Species:Danio rerio


Alignment Length:59 Identity:27/59 - (45%)
Similarity:33/59 - (55%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPE 154
            |..|..:.|...||.||.|||.|.||:..||..|:....:|:.||..||.|||||:..|
Zfish   104 RPKNATRESTSTLKAWLSEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_725183.1 Homeobox_KN 112..150 CDD:428673 18/37 (49%)
irx3bNP_998265.2 Homeobox_KN 120..158 CDD:428673 18/37 (49%)
Merozoite_SPAM 160..>268 CDD:429310 1/3 (33%)
IRO 261..278 CDD:214716
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.