DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and tgif1

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_955861.1 Gene:tgif1 / 321756 ZFINID:ZDB-GENE-030131-475 Length:273 Species:Danio rerio


Alignment Length:166 Identity:75/166 - (45%)
Similarity:97/166 - (58%) Gaps:39/166 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DQDSLHADVIVEEDQSTEHGANQVQNYHDMMVDSEHHIDINGSLRKRRGNLPKTSVKILKRWLYE 114
            |:|||                       |:.:|...:..::|. |||||||||.||:||:.|||:
Zfish    17 DEDSL-----------------------DVPLDLSSNGGVSGK-RKRRGNLPKESVQILRDWLYQ 57

  Fly   115 HRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKK----V 175
            ||||||||:.||..||::.:|:.|||||||||||||:||||:|::|.||..|||||||.|    :
Zfish    58 HRYNAYPSEQEKALLSKQTHLSTLQVCNWFINARRRLLPEMLRKDGKDPNQFTISRRGSKGGEML 122

  Fly   176 SPNCSRSSALGANLTG----------PNPAHGSPAS 201
            |.| |:|...|....|          |:|...:|.|
Zfish   123 SDN-SQSPKHGLLANGEDRNSYEPGSPHPTSNTPTS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 27/38 (71%)
tgif1NP_955861.1 Homeobox_KN 54..93 CDD:283551 27/38 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587145
Domainoid 1 1.000 71 1.000 Domainoid score I9384
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1573375at2759
OrthoFinder 1 1.000 - - FOG0002434
OrthoInspector 1 1.000 - - mtm6538
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2583
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.