DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and Tgif1

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001015020.1 Gene:Tgif1 / 316742 RGDID:1310517 Length:287 Species:Rattus norvegicus


Alignment Length:144 Identity:74/144 - (51%)
Similarity:93/144 - (64%) Gaps:24/144 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 DSEHH------IDINGSL----RKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLT 136
            |||..      :|::.|.    |:|||||||.||:||:.||||||||||||:.||..|||:.:|:
  Rat    29 DSEDEDSMDSPLDLSSSAASGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLS 93

  Fly   137 VLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVSPNCSRSSALGAN------------- 188
            .|||||||||||||:||:|:|::|.||..|||||||.|:|...|..:|:|..             
  Rat    94 TLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHS 158

  Fly   189 -LTGPNPAHGSPAS 201
             :.||||..|.|.|
  Rat   159 CVVGPNPTLGRPVS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 29/38 (76%)
Tgif1NP_001015020.1 Homeobox_KN 68..107 CDD:283551 29/38 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346192
Domainoid 1 1.000 73 1.000 Domainoid score I9009
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1573375at2759
OrthoFinder 1 1.000 - - FOG0002434
OrthoInspector 1 1.000 - - mtm8979
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2583
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.