DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and Meis2

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_038960864.1 Gene:Meis2 / 311311 RGDID:1305198 Length:496 Species:Rattus norvegicus


Alignment Length:300 Identity:75/300 - (25%)
Similarity:120/300 - (40%) Gaps:62/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EQEEVNMVLDRHVRQNIQDMMHEAHVQASLLENEGRGRF--------------HSDSSL----DQ 51
            |.|:|:.:.|....:.|..:..:..:...:.|.:|..:.              |:.||.    |.
  Rat   179 ELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDA 243

  Fly    52 DSLHA----------DVIVEEDQSTEHGANQVQNYHDMMVDSEHHIDINGSLRKRRGNLPKTSVK 106
            .|.|:          ......|.|:|.|.....:........:...|.:...:|:||..||.:..
  Rat   244 TSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATN 308

  Fly   107 ILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRR 171
            |::.||::|..:.|||:.:|..|:|:..||:|||.||||||||||:..||.:.         :|.
  Rat   309 IMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQS---------NRA 364

  Fly   172 GKKVSPNCSRSSALGANLTGPNPAHGSPASEVVVGATEEVDGAGEIHEGI--ANVLTNFEQYVQ- 233
            |..:.|:.|:.:|..        ..|.|....|:.        |:.|.||  |.:.:....||. 
  Rat   365 GFLLDPSVSQGAAYS--------PEGQPMGSFVLD--------GQQHMGIRPAGLQSMPGDYVSQ 413

  Fly   234 -GPNGQMVKMEPEYEDSVIYSWQQAIANNPMGFQSLHSSL 272
             ||.| |...:|.|....:......:.:.|    .:||.|
  Rat   414 GGPVG-MGMAQPSYTPPQMTPHPTQLRHGP----PMHSYL 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 21/38 (55%)
Meis2XP_038960864.1 Meis_PKNOX_N 129..213 CDD:406806 6/33 (18%)
Homeobox_KN 313..352 CDD:399131 21/38 (55%)
PAT1 <354..>482 CDD:401645 26/124 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346195
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.