DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and Irx1

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001100801.1 Gene:Irx1 / 306659 RGDID:1309060 Length:480 Species:Rattus norvegicus


Alignment Length:247 Identity:63/247 - (25%)
Similarity:96/247 - (38%) Gaps:45/247 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREG 160
            |..|..:.|...||.||.|||.|.||:..||..|:....:|:.||..||.|||||     :::|.
  Rat   130 RPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR-----LKKEN 189

  Fly   161 NDPLHFTISRRGKKVSPNCSRSSALGANLTGPNPAHGSPASEVVVGATEEVDGAGEIHEGIANVL 225
            .    .|...|.|.     ....||..:.|..:|.......|:.:.:. ::|...|.....:|  
  Rat   190 K----VTWGARSKD-----QEDGALFGSDTEGDPEKAEDDEEIDLESI-DIDQIDERDGDQSN-- 242

  Fly   226 TNFEQYVQGPNGQMVKMEPEYEDSVIYSWQQAI--ANNPMGFQSLHSSLQATMIDKIKNYQMRKA 288
            .:.|..|:.|..::....|..:.|...|..:.:  .::|:|.....|...:|           :.
  Rat   243 EDEEDKVEAPRARVAPPAPARDQSSPLSAAETLKSQDSPLGLAKEVSEPGST-----------RL 296

  Fly   289 AAIGGSAVGSGGAGGSS----SNSSPATSILPYSLFGQLPPEFDDEEKPRPP 336
            .:.|.:|||..||..|.    |.:..|||           |:...:..|.||
  Rat   297 LSPGAAAVGLQGAPHSKPKIWSLAETATS-----------PDGAPKASPPPP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 19/38 (50%)
Irx1NP_001100801.1 Homeobox_KN 145..184 CDD:283551 19/38 (50%)
SDA1 <194..>252 CDD:283052 12/65 (18%)
IRO 309..326 CDD:214716 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.