DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and Mkx

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_008770033.2 Gene:Mkx / 291228 RGDID:1305652 Length:356 Species:Rattus norvegicus


Alignment Length:400 Identity:93/400 - (23%)
Similarity:157/400 - (39%) Gaps:104/400 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IVEEDQST---EHGANQVQNYHDMMVDSEH---HIDI--------NGSLRKRR-GNLPKTSV--- 105
            ::.:|:.|   |.|:..    :..::|:.|   .:.|        |.|||.|| |..|...|   
  Rat    13 VIFDDRGTPDRERGSRP----YGGVLDNPHTGPEVGIPDGPPLKDNLSLRHRRTGARPGGKVRHK 73

  Fly   106 --------KILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGND 162
                    :.||:|||:||.|.||:..||..|:..:.:|::||.|||.|||||:...:  |:.:.
  Rat    74 RQALQDMARPLKQWLYKHRDNPYPTKTEKILLALGSQMTLVQVSNWFANARRRLKNTV--RQPDL 136

  Fly   163 PLHFTISRRGKKVSPNCSRSSALGANLT----GPNP--------AHGSPASEVVV-GATEEVDGA 214
            .....|....|.|..|..|.|...|:.:    |.||        .:.:||...|: |.:..:...
  Rat   137 SWALRIKLYNKYVQGNAERLSVSSADDSCSEDGENPPRTHMNEEGYSTPAHHTVIKGESSAIKAG 201

  Fly   215 GEIHEGIANVLTNFEQYVQGPNGQMVKMEPEYEDSVIYSWQQAIANNPMGFQSLHSSLQATMIDK 279
            |......|      |.||.         .|:|:.|::..:             |:.||:      
  Rat   202 GRPESRAA------EDYVS---------PPKYKSSLLNRY-------------LNDSLR------ 232

  Fly   280 IKNYQMRKAAAIGGSAVGSGGAGGSSSNSSPATSILPYSLFGQLPPEFDDEEKPRPPKRVRTRTV 344
               :.|..:.|:.|.......:|..|||......:.|.|          .|.:.....|..|..:
  Rat   233 ---HVMATSTAMMGKTRRRNHSGSFSSNEFEEELVSPSS----------SETEGTFVYRTDTPDI 284

  Fly   345 AAKSPRENAKQAKQKTGNKQETMYCYKDSYGGIVVSPRSEGEESAQG-YESCGPNSEEEVRFETS 408
            .:....:....|.::..:|.:|.  :|:....:.::..::|::.||| ..||       :..::|
  Rat   285 GSTKGDKGDSTANRRGPSKDDTH--WKEINAAMALTNLAQGKDEAQGTTTSC-------IIQKSS 340

  Fly   409 HDWQSVIKTV 418
            |  .:.:|||
  Rat   341 H--IAEVKTV 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 20/38 (53%)
MkxXP_008770033.2 Homeobox_KN 87..126 CDD:399131 20/38 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.