DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and MKX

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001229631.1 Gene:MKX / 283078 HGNCID:23729 Length:352 Species:Homo sapiens


Alignment Length:349 Identity:82/349 - (23%)
Similarity:135/349 - (38%) Gaps:94/349 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GSLRKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEM 155
            |.:|.:|..| :...:.||:|||:||.|.||:..||..|:..:.:|::||.|||.|||||:...:
Human    69 GKVRHKRQAL-QDMARPLKQWLYKHRDNPYPTKTEKILLALGSQMTLVQVSNWFANARRRLKNTV 132

  Fly   156 IRREGNDPLHFTISRRGKKVSPNCSR---SSALGANLTGPNP--------AHGSPASEVVVGATE 209
              |:.:......|....|.|..|..|   ||....:..|.||        .:.:|....|:.:..
Human   133 --RQPDLSWALRIKLYNKYVQGNAERLSVSSDDSCSEDGENPPRTHMNEGGYNTPVHHPVIKSEN 195

  Fly   210 EVDGAGEIHEGIANVLTNFEQYVQGPNGQMVKMEPEYEDSVIYSWQQAIANNPMGFQSLHSSLQA 274
            .|..||...|..|:     |.||         ..|:|:.|                         
Human   196 SVIKAGVRPESRAS-----EDYV---------APPKYKSS------------------------- 221

  Fly   275 TMIDKIKNYQMRKAAAIGGSAVGS----GGAGGSSSNSSPATSILPYSLFGQLPPEFDDEEKPRP 335
             ::::..|..:|...|...:.:|.    ..:|..|||                  ||  ||:...
Human   222 -LLNRYLNDSLRHVMATNTTMMGKTRQRNHSGSFSSN------------------EF--EEELVS 265

  Fly   336 PKRVRT------RTVAAKSPRENAKQAKQKTGNKQETMYCYKDSYGGIVVSPRSEGEESAQGYES 394
            |....|      ||...::.....:.|..:.|..::..| :|:....:.::..::|::..||..|
Human   266 PSSSETEGNFVYRTDTLENGSNKGESAANRKGPSKDDTY-WKEINAAMALTNLAQGKDKLQGTTS 329

  Fly   395 CGPNSEEEVRFETSHDWQSVIKTV 418
            |       :..::||  .:.:|||
Human   330 C-------IIQKSSH--IAEVKTV 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 20/38 (53%)
MKXNP_001229631.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..54
Homeobox_KN 88..127 CDD:399131 20/38 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..189 6/29 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..301 14/75 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.