DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and Tgif2

DIOPT Version :10

Sequence 1:NP_725183.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_775572.1 Gene:Tgif2 / 228839 MGIID:1915299 Length:237 Species:Mus musculus


Alignment Length:115 Identity:67/115 - (58%)
Similarity:83/115 - (72%) Gaps:5/115 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 DSEHHIDINGSLRKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFIN 146
            :.|..:.:.|. |||||||||.|||||:.|||.||||||||:.||.:||.:.||:|||:||||||
Mouse     8 EDEGLLSLTGK-RKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFIN 71

  Fly   147 ARRRILPEMIRREGNDPLHFTISRRGKKVS----PNCSRSSALGANLTGP 192
            ||||:||:|:|::|.||..|||||||.|.|    |..|..|.|..::..|
Mouse    72 ARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSLLAVSVPAP 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_725183.1 Homeobox_KN 112..150 CDD:428673 27/37 (73%)
Tgif2NP_775572.1 Homeobox_KN 37..75 CDD:428673 27/37 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..106 11/18 (61%)
Repressive function 103..237 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..196
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..237
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.