DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and Tgif1

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001157547.1 Gene:Tgif1 / 21815 MGIID:1194497 Length:305 Species:Mus musculus


Alignment Length:220 Identity:88/220 - (40%)
Similarity:116/220 - (52%) Gaps:57/220 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VNMVLD----RH-----VRQNIQDMMHEAHVQASLLENEGRGRFHSDSSLDQDSLHADVIVEEDQ 64
            :.|||.    ||     .||.::..:..| .:..::|.||........|.|:||:          
Mouse     1 MEMVLSPRAGRHDPASGFRQRVEGRVISA-PRPRVVELEGLVAASGSDSEDEDSM---------- 54

  Fly    65 STEHGANQVQNYHDMMVDSEHHIDINGSL----RKRRGNLPKTSVKILKRWLYEHRYNAYPSDAE 125
                             ||.  :|::.|.    |:|||||||.||:||:.||||||||||||:.|
Mouse    55 -----------------DSP--LDLSSSAASGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQE 100

  Fly   126 KFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVSPNCSRSSALGAN-- 188
            |..|||:.:|:.|||||||||||||:||:|:|::|.||..|||||||.|:|...|..:|:|..  
Mouse   101 KALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIEAAMGIKNF 165

  Fly   189 ------------LTGPNPAHGSPAS 201
                        :.||||..|.|.|
Mouse   166 MPTLEESPFHSCVVGPNPTLGRPVS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 29/38 (76%)
Tgif1NP_001157547.1 Homeobox_KN 86..125 CDD:283551 29/38 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842726
Domainoid 1 1.000 73 1.000 Domainoid score I9197
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3641
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1573375at2759
OrthoFinder 1 1.000 - - FOG0002434
OrthoInspector 1 1.000 - - mtm8740
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2583
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.660

Return to query results.
Submit another query.