DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and Pbx3

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_058048.1 Gene:Pbx3 / 18516 MGIID:97496 Length:434 Species:Mus musculus


Alignment Length:274 Identity:60/274 - (21%)
Similarity:97/274 - (35%) Gaps:98/274 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HVQASLLENEGRGRFHSDSSLDQ--DSLH---ADVIVEEDQSTEHGANQVQNYHDMMVDSEHHID 88
            ||. :||..:.|.|..|...:::  ..:|   :.:.::..|||         ...:|:.....:|
Mouse   180 HVM-NLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQST---------CEAVMILRSRFLD 234

  Fly    89 INGSLRKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRR--- 150
                .|::|.|..|.:.:||..:.|.|..|.|||:..|..|:::.::||.||.|||.|.|.|   
Mouse   235 ----ARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKK 295

  Fly   151 -----------------------ILPEMIRREGNDPL--------HFTI---------------- 168
                                   :...:...:.|.|.        .|.:                
Mouse   296 NIGKFQEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDMFMNMQSLNGD 360

  Fly   169 SRRGKKVSPNCSR---------------SSALGAN-LTGPN--PAHG------SPASEVVVGATE 209
            |.:|.:|..|...               |..|||| |..|:  .|:|      :|:|     .|.
Mouse   361 SYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGANSLYSPHNLNANGGWQDATTPSS-----VTS 420

  Fly   210 EVDGAGEIHEGIAN 223
            ..:|.|.:|...:|
Mouse   421 PTEGPGSVHSDTSN 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 17/38 (45%)
Pbx3NP_058048.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..41
PBC 43..234 CDD:397732 12/63 (19%)
homeodomain 236..296 CDD:238039 24/59 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 326..349 3/22 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..434 8/33 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842738
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.