DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and Meis3

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_036008636.1 Gene:Meis3 / 17537 MGIID:108519 Length:400 Species:Mus musculus


Alignment Length:219 Identity:62/219 - (28%)
Similarity:101/219 - (46%) Gaps:33/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VNMVL---DRHVRQNIQDMMHEAHVQASLLENEGRGRFHSDSSLDQDSLHADVIVEE-----DQS 65
            :::|:   |...|::::|  :.|...:...:|....|.|.||.    |:|.......     .||
Mouse   196 IDLVIEDRDGSCREDLED--YAASCPSLPDQNTTWIRDHEDSG----SVHLGTPGPSSGGLASQS 254

  Fly    66 TEHGANQVQNYHDMMVDS------EHHIDINGSLRKRRGNLPKTSVKILKRWLYEHRYNAYPSDA 124
            .::.::|.... |..|.|      :..:|:.....|:||..||.:..|::.||::|..:.|||:.
Mouse   255 GDNSSDQGDGL-DTSVASPSSAGEDEDLDLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEE 318

  Fly   125 EKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVSPNCSRSSALGANL 189
            :|..|:|:..||:|||.||||||||||:..||.:.         :|.|:..|.|.......|...
Mouse   319 QKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQS---------NRTGQGASFNPEGQPMAGFTE 374

  Fly   190 TGPNPAHGSPASEVVVGATEEVDG 213
            |.|.....:|.|   :|....::|
Mouse   375 TQPQVTVRTPGS---MGMNLNLEG 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 21/38 (55%)
Meis3XP_036008636.1 Meis_PKNOX_N 99..205 CDD:406806 1/8 (13%)
Homeobox_KN 305..344 CDD:399131 21/38 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842717
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.