DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and irx-1

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_492533.2 Gene:irx-1 / 172789 WormBaseID:WBGene00007984 Length:377 Species:Caenorhabditis elegans


Alignment Length:210 Identity:55/210 - (26%)
Similarity:85/210 - (40%) Gaps:41/210 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GRFHSDSSLDQD-SLHADVIVEEDQSTEHGANQVQNY-HDMMVDSEHHIDING------------ 91
            |:||...::.|. :..|.......|:|..|...|..: |.:..|.:..:.:.|            
 Worm    41 GQFHFHPAMAQVLAAQAQAAAAAQQATLAGFPGVPMFPHGIPADLKPEMLLGGGPGPMPMFFSDA 105

  Fly    92 ----------SLRKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFIN 146
                      .::||  |..:.:...||.||:.||.|.|||.|:|..|:....:|:.||..||.|
 Worm   106 HRLYHPYGLDGIKKR--NATREATAPLKDWLHSHRKNPYPSKADKVMLAVGTGMTLTQVSTWFAN 168

  Fly   147 ARRRI--------LPEMIRREG----NDPLHFTISRRGKKVSPNCSR--SSALG-ANLTGPNPAH 196
            ||||:        .|:..|.:|    .|.....::|.....|.|..|  .|..| .:|..|.|:.
 Worm   169 ARRRLKKENKMTWSPQNRRGDGCDDDEDDDDDDMNRPSSSTSINSERKGESLFGKPHLASPTPSG 233

  Fly   197 GSPASEVVVGATEEV 211
            ||..|:.:....:|:
 Worm   234 GSGGSDELTTPKKEL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 19/38 (50%)
irx-1NP_492533.2 Homeobox_KN 133..172 CDD:283551 19/38 (50%)
IRO 259..>273 CDD:214716
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.