DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and meis1b

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_571968.1 Gene:meis1b / 170446 ZFINID:ZDB-GENE-020122-1 Length:388 Species:Danio rerio


Alignment Length:245 Identity:63/245 - (25%)
Similarity:96/245 - (39%) Gaps:62/245 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EQEEVNMVLDRHVRQNIQDMMHEAHVQASLLENEGRGRFHSDSS--------LDQDSLHAD---- 57
            |.|:|:.:.|....:.|..:..:..:...:.:.||..:  |||.        |||.|.:.|    
Zfish   156 ELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSK--SDSEEITRSSGPLDQTSWNRDHDDT 218

  Fly    58 ----------------VIVEEDQSTEHGANQVQNYHDMMVDSEHHIDINGSLRKRRGNLPKTSVK 106
                            .....|.|:|.|.....:........:...|......|:||..||.:..
Zfish   219 ASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKEKKRNKKRGIFPKVATN 283

  Fly   107 ILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRR 171
            |::.||::|..:.|||:.:|..|:|:..||:|||.||||||||||:..||.:.            
Zfish   284 IMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQS------------ 336

  Fly   172 GKKVSPNCSRSSALGANLTGPNPAHGSPASEVVVGATEEVDGAGEIHEGI 221
                    :|:.:.||    |....|.|....|:.        |:.|.||
Zfish   337 --------NRAVSQGA----PYNPDGQPMGGFVMD--------GQQHMGI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 21/38 (55%)
meis1bNP_571968.1 Meis_PKNOX_N 106..190 CDD:406806 5/33 (15%)
Homeobox_KN 288..327 CDD:399131 21/38 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587131
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.