Sequence 1: | NP_001286352.1 | Gene: | achi / 36373 | FlyBaseID: | FBgn0033749 | Length: | 555 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571898.1 | Gene: | irx1b / 114430 | ZFINID: | ZDB-GENE-010716-1 | Length: | 445 | Species: | Danio rerio |
Alignment Length: | 334 | Identity: | 66/334 - (19%) |
---|---|---|---|
Similarity: | 114/334 - (34%) | Gaps: | 109/334 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 96 RRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPE------ 154
Fly 155 ------------------MIRREGNDPLHFTISRRGKKVSPNCSRSSALGAN------------L 189
Fly 190 TGP------NPAHGSPASEVVVGATEEVDGAGEIHEGIAN----VLTNFEQYVQGPNGQMVKM-- 242
Fly 243 -----------EPEY---------EDSVIYSWQQAI---ANNPMGFQSL---------HSSLQAT 275
Fly 276 MIDKIKNYQMRKAAAIGGSAVGSGGAGGSSSNSSPATSILPYSLFGQLPPEFDDEEKPRPPKRVR 340
Fly 341 TRTVAAKSP 349 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
achi | NP_001286352.1 | Homeobox_KN | 111..150 | CDD:283551 | 18/38 (47%) |
irx1b | NP_571898.1 | COG5576 | <114..206 | CDD:227863 | 24/85 (28%) |
Homeobox_KN | 135..174 | CDD:283551 | 18/38 (47%) | ||
IRO | 287..304 | CDD:214716 | 2/16 (13%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0773 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |