DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and irx1b

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_571898.1 Gene:irx1b / 114430 ZFINID:ZDB-GENE-010716-1 Length:445 Species:Danio rerio


Alignment Length:334 Identity:66/334 - (19%)
Similarity:114/334 - (34%) Gaps:109/334 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPE------ 154
            |..:..:.:...||.||.||:.|.||:..||..|:....:|:.||..||.|||||:..|      
Zfish   120 RAKSATRETTSTLKAWLQEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTCC 184

  Fly   155 ------------------MIRREGNDPLHFTISRRGKKVSPNCSRSSALGAN------------L 189
                              ..:.:..:.:........|...|...::.....|            |
Zfish   185 RSAEDRDGRIFDSDNEDDADKNDDEEEIDLETIDMDKAEEPRVDQNKEAANNPHAIENIETPRIL 249

  Fly   190 TGP------NPAHGSPASEVVVGATEEVDGAGEIHEGIAN----VLTNFEQYVQGPNGQMVKM-- 242
            :.|      :|.......:.||.:..||...|.:.:...|    :.:..|......|.|.:.:  
Zfish   250 SSPALKNTDSPMSSGNREQNVVKSVGEVSPGGAVCQRPGNSKPKIWSLAETATSPDNTQKLSIPS 314

  Fly   243 -----------EPEY---------EDSVIYSWQQAI---ANNPMGFQSL---------HSSLQAT 275
                       .|.:         :...:::|..|.   ||:.||.:||         ||     
Zfish   315 TPAGLRASPSTHPAFLSTNGIYTCQIGKLHNWASAAFLSANSLMGVRSLLSQNSNFPNHS----- 374

  Fly   276 MIDKIKNYQMRKAAAIGGSAVGSGGAGGSSSNSSPATSILPYSLFGQLPPEFDDEEKPRPPKRVR 340
               .:.|.:.:.::|.|...:       .|.|||.:.|           |:.:|:|.   .:|:.
Zfish   375 ---PVTNPEKKPSSASGSPCL-------DSDNSSDSFS-----------PKHNDQEN---VQRIE 415

  Fly   341 TRTVAAKSP 349
            :.|:|::||
Zfish   416 SPTLASRSP 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 18/38 (47%)
irx1bNP_571898.1 COG5576 <114..206 CDD:227863 24/85 (28%)
Homeobox_KN 135..174 CDD:283551 18/38 (47%)
IRO 287..304 CDD:214716 2/16 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.