Sequence 1: | NP_001286352.1 | Gene: | achi / 36373 | FlyBaseID: | FBgn0033749 | Length: | 555 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001120899.1 | Gene: | pknox2 / 100151724 | XenbaseID: | XB-GENE-853128 | Length: | 468 | Species: | Xenopus tropicalis |
Alignment Length: | 231 | Identity: | 63/231 - (27%) |
---|---|---|---|
Similarity: | 98/231 - (42%) | Gaps: | 57/231 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 SPEQEEVNMVLDRHVRQNIQDMMHEAHVQASLLENEGRGRFHSDSSLDQDSLHADVIVEED---- 63
Fly 64 ------------------QSTEHGANQVQNYH-----DMMVDSEHHIDINGSLRKRRGNLPKTSV 105
Fly 106 KILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISR 170
Fly 171 RGKKVS----------PNCSRSSAL--GANLTGPNP 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
achi | NP_001286352.1 | Homeobox_KN | 111..150 | CDD:283551 | 20/38 (53%) |
pknox2 | NP_001120899.1 | Meis_PKNOX_N | 95..180 | CDD:406806 | |
Homeobox_KN | 306..345 | CDD:399131 | 20/38 (53%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |