DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and tgif2

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_002932897.1 Gene:tgif2 / 100127190 XenbaseID:XB-GENE-876497 Length:266 Species:Xenopus tropicalis


Alignment Length:158 Identity:76/158 - (48%)
Similarity:102/158 - (64%) Gaps:24/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SDSSLDQDSLHADVIVEEDQSTEHGANQVQNYHDMMVDSEHHIDINGSLRKRRGNLPKTSVKILK 109
            :|..:|. |||.| ..|::.|:|                   :||:|:.|||||||||.:||||:
 Frog    11 TDHEIDH-SLHTD-SGEDEGSSE-------------------LDISGAKRKRRGNLPKDAVKILR 54

  Fly   110 RWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKK 174
            .||:|||:|||||:.||.:||.:.||||||:||||||||||:|||::|::|.||..|||||:|.|
 Frog    55 DWLFEHRFNAYPSEQEKLSLSGQTNLTVLQICNWFINARRRVLPELLRKDGKDPNQFTISRKGGK 119

  Fly   175 --VSPNCSRSSALGANLTGPNPAHGSPA 200
              ..|:....::|.:.|..| |....||
 Frog   120 SPEMPSPRTPTSLPSVLVMP-PTTAVPA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 28/38 (74%)
tgif2XP_002932897.1 Homeobox_KN 56..95 CDD:368670 28/38 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8971
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1573375at2759
OrthoFinder 1 1.000 - - FOG0002434
OrthoInspector 1 1.000 - - mtm9404
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2583
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.