DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and Tgif2lx2

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001136222.1 Gene:Tgif2lx2 / 100039551 MGIID:3800824 Length:231 Species:Mus musculus


Alignment Length:242 Identity:60/242 - (24%)
Similarity:107/242 - (44%) Gaps:39/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VEEDQSTEHGANQVQNYHD---MMVDSEHHIDINGSLRKRRGN-LPKTSVKILKRWLYEHRYNAY 120
            :||.:.:.........|:.   :.::....:..:.|....||| ||..|||||:.||.||::|||
Mouse     1 MEEAEGSPEETQDFMKYYSSFGIRLERTCKMKFHDSRELPRGNMLPLKSVKILRDWLCEHQFNAY 65

  Fly   121 PSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVSPNCSRSSAL 185
            |:.|:|..||:..:|:.|||.|||:|.|:.:..|:..:.      :::|..|:  :.|.::..  
Mouse    66 PTVADKRMLSKNTDLSYLQVSNWFVNIRKHLRWEIRYKP------YSLSHEGQ--AANAAQKQ-- 120

  Fly   186 GANLTGPNPAHGSPASEVVVGATEEVDGAGEIHEGIANVLTNFEQYV----QGPNGQMV---KME 243
                      |.:|:.||.....|..|    :.:....:..:.|:.|    ..||.:::   .:|
Mouse   121 ----------HSNPSEEVKTQFNENAD----MQDLPLPIRQDSEEKVPYLESSPNQKVIAEDNIE 171

  Fly   244 PEYEDSVIYSW---QQAIANNPMGFQSLHSSLQATMIDKIKNYQMRK 287
            .|.:.|:...|   :.|.......|.|.: .|....:.|.|..:.:|
Mouse   172 KEEKISITEPWSSPEVAWPEEKPDFSSFY-MLVDVAVQKAKEMEEQK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 21/38 (55%)
Tgif2lx2NP_001136222.1 Homeobox_KN 56..94 CDD:283551 20/37 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842723
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D627308at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.710

Return to query results.
Submit another query.