DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment achi and irx1

DIOPT Version :9

Sequence 1:	NP_001286352.1	Gene:	achi / 36373	FlyBaseID:	FBgn0033749	Length:	555	Species:	Drosophila melanogaster
Sequence 2:	NP_001188351.1	Gene:	irx1 / 100038208	XenbaseID:	XB-GENE-486817	Length:	467	Species:	Xenopus tropicalis

Alignment Length:	59	Identity:	27/59 - (45%)
Similarity:	33/59 - (55%)	Gaps:	0/59 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    96 RRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPE 154
            |..|..:.|...||.||.|||.|.||:..||..|:....:|:.||..||.|||||:..|
Frog   129 RPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 187

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
achi	NP_001286352.1	Homeobox_KN	111..150	CDD:283551	19/38 (50%)
irx1	NP_001188351.1	Homeobox_KN	144..183	CDD:283551	19/38 (50%)
irx1	NP_001188351.1	IRO	303..320	CDD:214716
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910