DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and irx1

DIOPT Version :10

Sequence 1:NP_725183.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001188351.1 Gene:irx1 / 100038208 XenbaseID:XB-GENE-486817 Length:467 Species:Xenopus tropicalis


Alignment Length:59 Identity:27/59 - (45%)
Similarity:33/59 - (55%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPE 154
            |..|..:.|...||.||.|||.|.||:..||..|:....:|:.||..||.|||||:..|
 Frog   129 RPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_725183.1 Homeobox_KN 112..150 CDD:428673 18/37 (49%)
irx1NP_001188351.1 Homeobox_KN 145..183 CDD:428673 18/37 (49%)
IRO 303..320 CDD:214716
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.