DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and TGIF2LX

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_620410.3 Gene:TGIF2LX / 90316 HGNCID:18570 Length:241 Species:Homo sapiens


Alignment Length:162 Identity:64/162 - (39%)
Similarity:90/162 - (55%) Gaps:31/162 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 DMMVDSEHHVDINGSL------RKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLT 134
            |..:.|.::.|....|      :||:||||..|||||:.|:|:||:.||||:.||..||::.||:
Human    29 DTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLS 93

  Fly   135 VLQVCNWFINARRRILPEMIRREGNDPL--HFTISRRGKKV----VGATEEVDGAGEIHEGIANV 193
            :||:.||||||||||||:|:::..|||:  |.|    ||..    :.:||....|.....|..| 
Human    94 LLQISNWFINARRRILPDMLQQRRNDPIIGHKT----GKDAHATHLQSTEASVPAKSGPSGPDN- 153

  Fly   194 LTNFEQYVQG------PNGQMVK-MEPEYEDS 218
                   ||.      |.|||.: .:|:.|.:
Human   154 -------VQSLPLWPLPKGQMSREKQPDPESA 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 23/38 (61%)
TGIF2LXNP_620410.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 8/28 (29%)
Homeobox_KN 68..107 CDD:283551 23/38 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..210 16/65 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152666
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D627308at33208
OrthoFinder 1 1.000 - - FOG0002434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.