DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and CUP9

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_015148.1 Gene:CUP9 / 855926 SGDID:S000006098 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:146 Identity:44/146 - (30%)
Similarity:62/146 - (42%) Gaps:22/146 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EQGANQVQNYHDMMVDSEHHVDINGSLRKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQ 129
            :.||...:.:.|.:.........:|    ||.||||.:|:||..||..|..|.||:..||..|..
Yeast   140 DAGAQYNRPFSDFVESKSRRKQNSG----RRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLI 200

  Fly   130 EANLTVLQVCNWFINARRR-------ILPEMIRRE--GNDPL---------HFTISRRGKKVVGA 176
            :..||.:|:.|||||.|||       .|...|..:  .|.|:         |.|:|.....:..|
Yeast   201 KTGLTKIQLSNWFINVRRRKIFSDYYTLVNSIPNDNANNTPVERVQNVSAYHNTLSATNNTMYDA 265

  Fly   177 TEEVDGAGEIHEGIAN 192
            |.......|:.:..|:
Yeast   266 TSTCSTDYELSKRFAH 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 18/38 (47%)
CUP9NP_015148.1 Homeobox_KN 180..219 CDD:399131 18/38 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9183
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2315
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.