DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and MATALPHA2

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_009868.3 Gene:MATALPHA2 / 850406 SGDID:S000000635 Length:210 Species:Saccharomyces cerevisiae


Alignment Length:111 Identity:29/111 - (26%)
Similarity:51/111 - (45%) Gaps:6/111 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VGNDLSTEQGANQVQNYHDMMVDSEHHVDINGSLRKRRGN-LPKSSVKILKRWLYEHRYNAYPSD 121
            :.||.|..|...:.::...::.:......||.|.:..||: ..|.:|:||:.|..::..|.|...
Yeast    95 IENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDT 159

  Fly   122 AEKFTLSQEANLTVLQVCNWFINARRR-----ILPEMIRREGNDPL 162
            .....|.:..:|:.:|:.||..|.||:     |.||:......:||
Yeast   160 KGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 10/38 (26%)
MATALPHA2NP_009868.3 HOX 135..188 CDD:197696 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.