DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and BLH11

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_177676.2 Gene:BLH11 / 843879 AraportID:AT1G75430 Length:290 Species:Arabidopsis thaliana


Alignment Length:146 Identity:53/146 - (36%)
Similarity:72/146 - (49%) Gaps:29/146 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NEGRDRF---HSD------SSLDQDSLHAVVGNDLSTE-QGANQVQNYHDMMVDSEHHVDINGSL 91
            |..|.||   |.|      |.|.|.||..  ||..|:. |....||.       .:.|     :.
plant   153 NSVRRRFIISHQDVPKIISSGLSQLSLFD--GNTTSSSLQRLGLVQG-------PQRH-----AW 203

  Fly    92 RKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRI----LPE 152
            :..|| ||::||.||:.||::|..:.||::|||..|:.:..|:..||.|||||||.|:    :.|
plant   204 KPIRG-LPETSVAILRAWLFQHFLHPYPNEAEKLVLASQTGLSKNQVSNWFINARVRLWKPMIEE 267

  Fly   153 MIRREGNDPLHFTISR 168
            |.|.|..|.|..::.|
plant   268 MYREEFGDSLDESMQR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 19/38 (50%)
BLH11NP_177676.2 POX 16..148 CDD:400075
Homeobox_KN 220..259 CDD:399131 19/38 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.