DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and BLH3

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001077827.1 Gene:BLH3 / 843877 AraportID:AT1G75410 Length:524 Species:Arabidopsis thaliana


Alignment Length:259 Identity:61/259 - (23%)
Similarity:113/259 - (43%) Gaps:48/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ISP-EQEEVN------MVLDRHVRQNIKDLMHEAHVHAS---LLNNEGRDRFHSDSSLDQDSLHA 56
            :|| |::|:.      :.:...|.:......|:....||   ::...|..:.::..:|::.|.|.
plant   225 LSPSERQELQSKKSKLLTMVDEVDKRYNQYHHQMEALASSFEMVTGLGAAKPYTSVALNRISRHF 289

  Fly    57 VVGNDLSTEQ--------GANQVQNYHDMMVDSEHHVD---------------INGSLRKRRGNL 98
            ....|...||        |..:..:.....:....::|               :..:.|.:|| |
plant   290 RCLRDAIKEQIQVIRGKLGERETSDEQGERIPRLRYLDQRLRQQRALHQQLGMVRPAWRPQRG-L 353

  Fly    99 PKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRI----LPEMIRRE-G 158
            |::||.||:.||:||..:.||.::||..||::..|:..||.|||||||.|:    :.||.:.| |
plant   354 PENSVSILRAWLFEHFLHPYPKESEKIMLSKQTGLSKNQVANWFINARVRLWKPMIEEMYKEEFG 418

  Fly   159 NDPLHFTISRRGKKVVGATEEVDGAGEIHEGIANVLTNFEQYVQGPNGQMVKMEPEYEDSVIYS 222
            ......:.|.:..|.:..|.::.     ||.    .::.:|..||.|...:....:.|.:::::
plant   419 ESAELLSNSNQDTKKMQETSQLK-----HED----SSSSQQQNQGNNNNNIPYTSDAEQNLVFA 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 20/38 (53%)
BLH3NP_001077827.1 POX 168..296 CDD:400075 13/70 (19%)
Homeobox_KN 364..403 CDD:399131 20/38 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.