DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and KNAT7

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_564805.1 Gene:KNAT7 / 842602 AraportID:AT1G62990 Length:291 Species:Arabidopsis thaliana


Alignment Length:204 Identity:46/204 - (22%)
Similarity:66/204 - (32%) Gaps:85/204 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DRHVRQNI------------KDLMHEAHVHA--------SLLNNEGRDRFHSDSSLDQDSLHAVV 58
            |||...|.            :.|.....|||        .:.||                ||::.
plant    86 DRHELDNFLAQYVMVLCSFKEQLQQHVRVHAVEAVMACREIENN----------------LHSLT 134

  Fly    59 GNDLSTEQGANQVQNYHDMMVD---SEHHVDINGS------------------------------ 90
            |..|....||...::..|:.:|   ....||.:|.                              
plant   135 GATLGEGSGATMSEDEDDLPMDFSSDNSGVDFSGGHDMTGFGPLLPTESERSLMERVRQELKLEL 199

  Fly    91 ---------------LRKRR-GNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVC 139
                           :|||| |.||..:..:||.|..:|....||::.:|..|.:|..|.:.|:.
plant   200 KQGFKSRIEDVREEIMRKRRAGKLPGDTTTVLKNWWQQHCKWPYPTEDDKAKLVEETGLQLKQIN 264

  Fly   140 NWFINARRR 148
            |||||.|:|
plant   265 NWFINQRKR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 15/38 (39%)
KNAT7NP_564805.1 KNOX1 29..67 CDD:281744
KNOX2 84..134 CDD:281745 12/63 (19%)
Homeobox_KN 234..273 CDD:283551 15/38 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.