DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and KNAT6

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_173752.3 Gene:KNAT6 / 838946 AraportID:AT1G23380 Length:329 Species:Arabidopsis thaliana


Alignment Length:111 Identity:31/111 - (27%)
Similarity:49/111 - (44%) Gaps:22/111 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EGRDRFHSDSSLDQDSLHAVVGNDLSTEQGANQVQNYHDMMVDSEHHVDINGSLRKRRGNLPKSS 102
            :||.|. .|..| :|.|....|:.:||                    :.:..|.:|::|.||:.:
plant   217 DGRQRC-EDRDL-KDRLLRKFGSRIST--------------------LKLEFSKKKKKGKLPREA 259

  Fly   103 VKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRR 148
            .:.|..|...|....||::.:|..|:....|...|:.|||||.|:|
plant   260 RQALLDWWNLHYKWPYPTEGDKIALADATGLDQKQINNWFINQRKR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 14/38 (37%)
KNAT6NP_173752.3 KNOX1 85..125 CDD:397730
KNOX2 139..186 CDD:397731
ELK 226..247 CDD:397729 6/41 (15%)
Homeobox_KN 266..305 CDD:399131 14/38 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.