DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and BEL10

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001154352.1 Gene:BEL10 / 838558 AraportID:AT1G19700 Length:538 Species:Arabidopsis thaliana


Alignment Length:223 Identity:58/223 - (26%)
Similarity:98/223 - (43%) Gaps:21/223 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RDRFHSDSSLDQDSLHAVVGNDLSTEQGANQVQ-NYHDMMVDSEHHVD-----INGSLRKRRGNL 98
            ||.......:.::.|....|..|..:||....: .|.|..:..:..:.     :..:.|.:|| |
plant   295 RDAIKEQIQIVREKLGEKGGESLDEQQGERIPRLRYLDQRLRQQRALHQQLGMVRPAWRPQRG-L 358

  Fly    99 PKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRI----LPEMIRREGN 159
            |::||.:|:.||:||..:.||.::||..|:::..|:..||.|||||||.|:    :.||.:.|..
plant   359 PENSVSVLRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMIEEMYKEEFG 423

  Fly   160 DPLHFTISRRGKKVVGATEEVDGAGEIHEGIANVLTNFEQYVQGPNGQMVKMEPEYEDSVIYSWQ 224
            |.....||:..:: ..:|.:.|.:.:..:...|...:...|.......:|.......|.|:.:  
plant   424 DESELLISKSSQE-PNSTNQEDSSSQQQQQQENNNNSNLAYSSADTTNIVFSSETKPDRVLGN-- 485

  Fly   225 QAIANNPMGFQSLHSSLQATMIDKIKNY 252
               .|:|...|...||    ..|.:.||
plant   486 ---DNDPQQQQINRSS----DYDTLMNY 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 19/38 (50%)
BEL10NP_001154352.1 POX 166..298 CDD:369404 2/2 (100%)
Homeobox_KN 369..408 CDD:368670 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.