DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and BEL1

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_198957.1 Gene:BEL1 / 834143 AraportID:AT5G41410 Length:611 Species:Arabidopsis thaliana


Alignment Length:273 Identity:73/273 - (26%)
Similarity:114/273 - (41%) Gaps:75/273 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EQGANQVQNYHDMMVDSEHHVDINGSLRKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQ 129
            :|...|.::|..|.:...|      ..|.:|| ||:.:|..|:.||:||..:.||||.:|..|::
plant   372 DQALRQQKSYRQMTLVDAH------PWRPQRG-LPERAVTTLRAWLFEHFLHPYPSDVDKHILAR 429

  Fly   130 EANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVVGATEEVDGAGEIHEGIANVL 194
            :..|:..||.|||||||.|:...||     :.::...:|        :|:::            :
plant   430 QTGLSRSQVSNWFINARVRLWKPMI-----EEMYCEETR--------SEQME------------I 469

  Fly   195 TNFEQYVQGPN-GQMVKMEPEYEDSVIYSWQQAIANNP---MGFQSLHS--SLQATMIDKIKNYQ 253
            ||.......|: .|::::|||...|::        .||   .|..|.|.  ||.:|....:...|
plant   470 TNPMMIDTKPDPDQLIRVEPESLSSIV--------TNPTSKSGHNSTHGTMSLGSTFDFSLYGNQ 526

  Fly   254 MRKAAAIGGS------AVG---SGGAGGSSSNSSPATSILPYSLFGQL----------PPEF--- 296
            ....|..||.      .:|   :.|.||.|...||.|     :..|||          |.::   
plant   527 AVTYAGEGGPRGDVSLTLGLQRNDGNGGVSLALSPVT-----AQGGQLFYGRDHIEEGPVQYSAS 586

  Fly   297 --DDEEKPRPPKR 307
              ||::....|.|
plant   587 MLDDDQVQNLPYR 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 20/38 (53%)
BEL1NP_198957.1 POX 192..338 CDD:214728
Homeobox_KN 409..448 CDD:283551 20/38 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.