DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and KNAT3

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_197904.1 Gene:KNAT3 / 832593 AraportID:AT5G25220 Length:431 Species:Arabidopsis thaliana


Alignment Length:166 Identity:43/166 - (25%)
Similarity:73/166 - (43%) Gaps:35/166 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LDRHVR--------------QNIKDL--MHEAHVHASLLNNEGRDRFHSDSSLDQDSLHAV-VGN 60
            |.:|||              |:::.|  :.......:.::::..::..||:::....|..: .|.
plant   241 LQQHVRVHAMEAVMACWEIEQSLQSLTGVSPGEGMGATMSDDEDEQVESDANMFDGGLDVLGFGP 305

  Fly    61 DLSTEQGANQV------------QNYHDMMVDSEHHVDINGSLRKRR-GNLPKSSVKILKRWLYE 112
            .:.||...:.:            |.|.:.:||....:     ||||| |.||..:..:||.|...
plant   306 LIPTESERSLMERVRQELKHELKQGYKEKIVDIREEI-----LRKRRAGKLPGDTTSVLKAWWQS 365

  Fly   113 HRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRR 148
            |....||::.:|..|.||..|.:.|:.|||||.|:|
plant   366 HSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 16/38 (42%)
KNAT3NP_197904.1 KNOX1 160..197 CDD:281744
KNOX2 217..267 CDD:281745 5/25 (20%)
ELK 322..343 CDD:281743 4/25 (16%)
Homeobox_KN 362..401 CDD:283551 16/38 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.