DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and KNAT4

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_196667.2 Gene:KNAT4 / 830973 AraportID:AT5G11060 Length:393 Species:Arabidopsis thaliana


Alignment Length:203 Identity:52/203 - (25%)
Similarity:85/203 - (41%) Gaps:50/203 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LDRHVRQN-IKDLMHEAHVHASL---------------LNNEGRDRFHSDSSLDQDSLHAV-VGN 60
            |.:|||.: ::.:|....:..||               ::.:..::..||:.|...||..: .|.
plant   205 LQQHVRVHAMEAVMACWEIEQSLQSFTGVSPGEGTGATMSEDEDEQVESDAHLFDGSLDGLGFGP 269

  Fly    61 DLSTEQGANQV------------QNYHDMMVDSEHHVDINGSLRKRR-GNLPKSSVKILKRWLYE 112
            .:.||...:.:            |.|.:.:||....:     ||||| |.||..:..:||.|...
plant   270 LVPTESERSLMERVRQELKHELKQGYKEKIVDIREEI-----LRKRRAGKLPGDTTSVLKSWWQS 329

  Fly   113 HRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVVGAT 177
            |....||::.:|..|.||..|.:.|:.|||||.|:       |...::|...|:|:..::     
plant   330 HSKWPYPTEEDKARLVQETGLQLKQINNWFINQRK-------RNWHSNPSSSTVSKNKRR----- 382

  Fly   178 EEVDGAGE 185
               ..|||
plant   383 ---SNAGE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 16/38 (42%)
KNAT4NP_196667.2 KNOX1 124..161 CDD:281744
KNOX2 182..231 CDD:281745 7/25 (28%)
ELK 286..307 CDD:281743 4/25 (16%)
Homeobox_KN 326..365 CDD:283551 16/45 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.