DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and BLH2

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001031797.4 Gene:BLH2 / 829840 AraportID:AT4G36870 Length:739 Species:Arabidopsis thaliana


Alignment Length:357 Identity:86/357 - (24%)
Similarity:139/357 - (38%) Gaps:120/357 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EQGANQVQNYHDM-MVDSEHHVDINGSLRKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLS 128
            ||...|.:.:|.| |::.|       :.|.:|| ||:.||.||:.||:||..:.|||||:|..|:
plant   479 EQSLRQNRAFHQMGMMEQE-------AWRPQRG-LPERSVNILRAWLFEHFLHPYPSDADKHLLA 535

  Fly   129 QEANLTVLQVCNWFINARRRI----LPEMIRREGNDPLHFTISRRGKKVVGATEEVDGAGEIHEG 189
            ::..|:..||.|||||||.|:    :.||.::|..:       |..::.:...||          
plant   536 RQTGLSRNQVSNWFINARVRLWKPMVEEMYQQESKE-------REREEELEENEE---------- 583

  Fly   190 IANVLTNFEQYVQGPNGQMVKMEPEYEDSVIYSWQQAIANNPMGFQSLHSSLQ---ATMIDKIKN 251
                    :|..:..|          :|....|     .||...|.::.::.|   .|..|    
plant   584 --------DQETKNSN----------DDKSTKS-----NNNESNFTAVRTTSQTPTTTAPD---- 621

  Fly   252 YQMRKAAAIGGSAVGSGGAGGSSSNS--SPATSILPYSLFGQLPPEFDDEEKPRPPKRVRTRTVA 314
                  |:...:||.:|....|:.|:  :.|:|:|       ||..:.:...|           |
plant   622 ------ASDADAAVATGHRLRSNINAYENDASSLL-------LPSSYSNAAAP-----------A 662

  Fly   315 AKSPRENAKQAKQKTGNKQETMYCYKDSYGGIVVSPRSEGEESAQGYESCGPNSEEEVRFETSHD 379
            |.|...|::             |...|::..:....:|.|     |::....:....:||.|:  
plant   663 AVSDDLNSR-------------YGGSDAFSAVATCQQSVG-----GFDDADMDGVNVIRFGTN-- 707

  Fly   380 WQSVIKTVFGTEEVSTS-----AGNNPGTSGS 406
                     .|.:||.:     |||.|....|
plant   708 ---------PTGDVSLTLGLRHAGNMPDKDAS 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 21/38 (55%)
BLH2NP_001031797.4 POX 310..445 CDD:214728
Homeobox_KN 516..555 CDD:283551 21/38 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.860

Return to query results.
Submit another query.