DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and BLH6

DIOPT Version :10

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_195187.1 Gene:BLH6 / 829613 AraportID:AT4G34610 Length:532 Species:Arabidopsis thaliana


Alignment Length:79 Identity:31/79 - (39%)
Similarity:48/79 - (60%) Gaps:11/79 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 INGSLRKRRG-----------NLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCN 140
            ::..||::||           .||::||.||:.||:||..:.||.|::|..|:::..|:..||.|
plant   299 VDQHLRQQRGFMQPQAWRPQRGLPENSVLILRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSN 363

  Fly   141 WFINARRRILPEMI 154
            ||||||.|:...|:
plant   364 WFINARVRLWKPMV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 110..148 CDD:428673 18/37 (49%)
BLH6NP_195187.1 POX 135..269 CDD:214728
Homeobox_KN 333..371 CDD:428673 18/37 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.