DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and BLH5

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001189615.2 Gene:BLH5 / 817264 AraportID:AT2G27220 Length:449 Species:Arabidopsis thaliana


Alignment Length:182 Identity:51/182 - (28%)
Similarity:82/182 - (45%) Gaps:30/182 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EVNMVLDRHVRQNIK---DLMH---------------EAHVHASLLNNEGRDRFHSDS-SLDQDS 53
            |:|:|....|.|..|   |.|.               .::.|.:|.....:.|...|. ||....
plant   155 EMNLVNYTQVEQRYKQYHDQMQTIISSFEQAAGLGSANSYTHMALQTISKQFRAVKDMISLQIKQ 219

  Fly    54 LHAVVGNDLSTEQGANQVQNYHDMMVDSEHHVDINGSLRKRRGNLPKSSVKILKRWLYEHRYNAY 118
            ::.::|.....||.....:..|       ||   :.:.|.:|| ||:.:|.:|:.||:||..:.|
plant   220 INKLLGQKEFDEQLKKLGKMAH-------HH---SNAWRPQRG-LPEKAVSVLRSWLFEHFLHPY 273

  Fly   119 PSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRG 170
            |.|.:|..|:::..||..||.|||||||.|:...::....::.:....||:|
plant   274 PRDLDKVMLAKQTGLTKSQVSNWFINARVRMWKPLVEELYSEEMDIEESRKG 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 20/38 (53%)
BLH5NP_001189615.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.