DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and BLH7

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_179233.1 Gene:BLH7 / 816137 AraportID:AT2G16400 Length:482 Species:Arabidopsis thaliana


Alignment Length:196 Identity:55/196 - (28%)
Similarity:90/196 - (45%) Gaps:40/196 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EQEEVNMVLDR------HVRQNIKDLMHEAHVHAS---LLNNEGRDRFHSDSSLDQDSLH----- 55
            |::|:...|.:      .|.:|.|...|:..:..|   ::...|..:.::..:|...|.|     
plant   167 ERQELQSKLSKLLSILDEVDRNYKQYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLR 231

  Fly    56 -------AVVGNDLSTEQ--------GANQVQNYHDMMVDSEHHVDINGSL-----RKRRGNLPK 100
                   .|:...|..||        |.::::|. |..|..:..:...|.:     |.:|| ||.
plant   232 DAISGQILVIRKSLGGEQDGSDGRGVGISRLRNV-DQQVRQQRALQRLGVMQPHTWRPQRG-LPD 294

  Fly   101 SSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRI----LPEMIRREGNDP 161
            |||.:|:.||:||..:.||.|::|..|:::..|:..||.|||||||.|:    :.||.:.|..|.
plant   295 SSVLVLRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARVRLWKPMVEEMYKEEFTDA 359

  Fly   162 L 162
            |
plant   360 L 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 19/38 (50%)
BLH7NP_179233.1 POX 109..236 CDD:214728 12/68 (18%)
Homeobox_KN 303..342 CDD:399131 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.