DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and PBX4

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_011526622.1 Gene:PBX4 / 80714 HGNCID:13403 Length:391 Species:Homo sapiens


Alignment Length:155 Identity:41/155 - (26%)
Similarity:68/155 - (43%) Gaps:22/155 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HVHASLLNNEGRDRFHSDSSLDQDSLHAVVGNDLSTEQGANQ-----VQNYHDMMVDSEHHVDIN 88
            || .:||..:.|.|..|...::: .:.|:.|...:.:....|     |......::|:       
Human   172 HV-TNLLQEQSRMRPVSPKEIER-MVGAIHGKFSAIQMQLKQSTCEAVMTLRSRLLDA------- 227

  Fly    89 GSLRKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEM 153
               |::|.|..|.:.::|..:.|.|..|.|||:..|..|:::..||:.||.|||.|.|.|....|
Human   228 ---RRKRRNFSKQATEVLNEYFYSHLNNPYPSEEAKEELARKGGLTISQVSNWFGNKRIRYKKNM 289

  Fly   154 IRREGNDPLHFTISRRGKKVVGATE 178
            .:.:....::     .||..|..||
Human   290 GKFQEEATIY-----TGKTAVDTTE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 17/38 (45%)
PBX4XP_011526622.1 PBC 18..226 CDD:281746 11/55 (20%)
homeodomain 228..289 CDD:238039 23/60 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152653
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.