DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and IRX1

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_077313.3 Gene:IRX1 / 79192 HGNCID:14358 Length:480 Species:Homo sapiens


Alignment Length:254 Identity:66/254 - (25%)
Similarity:86/254 - (33%) Gaps:73/254 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 RRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREG 158
            |..|..:.|...||.||.|||.|.||:..||..|:....:|:.||..||.|||||     :::|.
Human   130 RPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR-----LKKEN 189

  Fly   159 NDPLHFTISRRGKKVVGATEEVDGA--GEIHEGIANVLTNFEQYVQGPNGQMVKMEPE--YEDSV 219
            .    .|...|.|      ::.|||  |...||                      :||  .:|..
Human   190 K----VTWGARSK------DQEDGALFGSDTEG----------------------DPEKAEDDEE 222

  Fly   220 IYSWQQAIANNPMGFQSLHSSLQATMIDKIKNY--------QMRKAAAIGGSAVGSGGAGGSSSN 276
            |                   .|::..||||..:        ...||.|....|..|..|....|.
Human   223 I-------------------DLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSP 268

  Fly   277 SSPATSILPYSLFGQLPPEFDDEEKPRPPKRVRTRTVAAKSPRENAKQAKQKTGNKQET 335
            .:.|..:.|     |..|....:|.|.|.........||....:.|...|.|..:..||
Human   269 LAAADVLKP-----QDSPLGLAKEAPEPGSTRLLSPGAAAGGLQGAPHGKPKIWSLAET 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 19/38 (50%)
IRX1NP_077313.3 Homeobox_KN 145..184 CDD:399131 19/38 (50%)
HARE-HTH <188..247 CDD:412843 19/109 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..268 24/128 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..354 11/43 (26%)
IRO <313..326 CDD:214716 4/10 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.