DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and TGIF1

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_775299.1 Gene:TGIF1 / 7050 HGNCID:11776 Length:286 Species:Homo sapiens


Alignment Length:245 Identity:94/245 - (38%)
Similarity:131/245 - (53%) Gaps:51/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AHVHASLLNNEGRDRFHSDSSLDQDSLHAVVGNDLSTEQGANQVQNYHDMMVDSEHHVDINGSLR 92
            |...:||.:::|........:.|:||:.  :..|||:..|:.:                     |
Human     9 ALARSSLTSSQGIVAASGSETEDEDSMD--IPLDLSSSAGSGK---------------------R 50

  Fly    93 KRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRRE 157
            :|||||||.||:||:.||||||||||||:.||..|||:.:|:.|||||||||||||:||:|:|::
Human    51 RRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKD 115

  Fly   158 GNDPLHFTISRRGKKVVGATEEVDGAGEIHEGIANVL-----TNFEQYVQGPN---GQMVKMEPE 214
            |.||..|||||||.| :..|..|:..    .||.|.:     |.|.....|||   |:.:..:|.
Human   116 GKDPNQFTISRRGAK-ISETSSVESV----MGIKNFMPALEETPFHSCTAGPNPTLGRPLSPKPS 175

  Fly   215 YEDSVI-------YSWQQAIANNPMGFQSLHSSL---QATMIDKI--KNY 252
            ...||:       ::...|:.:.|.   ||..|:   |.|.|.:|  ||:
Human   176 SPGSVLARPSVICHTTVTALKDVPF---SLCQSVGVGQNTDIQQIAAKNF 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 29/38 (76%)
TGIF1NP_775299.1 Homeobox_KN 67..106 CDD:283551 29/38 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152671
Domainoid 1 1.000 73 1.000 Domainoid score I9250
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1573375at2759
OrthoFinder 1 1.000 - - FOG0002434
OrthoInspector 1 1.000 - - mtm8506
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2315
SonicParanoid 1 1.000 - - X2583
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.