DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and pbx3b

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_009302358.1 Gene:pbx3b / 58140 ZFINID:ZDB-GENE-000405-3 Length:471 Species:Danio rerio


Alignment Length:309 Identity:67/309 - (21%)
Similarity:116/309 - (37%) Gaps:83/309 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HVHASLLNNEGRDRFHSDSSLDQDSLHAVVGNDLSTEQGANQVQNYHDMMVDSEHHVDINGSLRK 93
            || .:||..:.|.|..|...:::  :.:::....|:.|...:......:|:.....:|    .|:
Zfish   181 HV-MNLLREQSRTRPISPKEIER--MVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLD----ARR 238

  Fly    94 RRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEAN----------LTVLQVCNWFINARRR 148
            :|.|..|.:.:||..:.|.|..|.|||:..|..|:::.:          :||.||.|||.|.|.|
Zfish   239 KRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQGVGTTITVAQVSNWFGNKRIR 303

  Fly   149 ILPEMIRREGNDPLHFTISRRGKKVVGATEE----------VDGAGEIHEGIANVLTNFEQYVQG 203
            .                     ||.:|..:|          |..|......:.|..||..   ..
Zfish   304 Y---------------------KKNIGKFQEEANLYAAKTAVTAAHAAAAAVQNSQTNSP---TT 344

  Fly   204 PNGQMVKMEPEYE-DSV---------IYSWQQAIANNP------MGFQSLH-SSLQA-------- 243
            ||......:.|:: ||.         :::......|.|      |..|:|: .|.|.        
Zfish   345 PNSGFQMKDEEFQLDSAENKNTLLTNMFTGSSGSFNLPNSGDLFMSMQNLNGDSYQGAQVGANVQ 409

  Fly   244 TMIDKIKNYQMRKAA---AIGGSAV----GSGGAGGSSSNSSPATSILP 285
            :.:|.:::...:.|.   .:||:.:    |..|.||....::|::.|.|
Zfish   410 SQVDTLRHVISQTAGYNDVLGGNPMYSPHGLNGNGGWQDATTPSSVISP 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 17/48 (35%)
pbx3bXP_009302358.1 PBC 42..235 CDD:281746 10/56 (18%)
homeodomain 237..307 CDD:238039 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.